PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A00475.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 332aa    MW: 36211.5 Da    PI: 8.8728
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A00475.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.16.8e-4060137178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC  +l +ak+yhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Pahal.A00475.1  60 RCQVEGCGLELGTAKDYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 137
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.3E-3354122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.7758135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-3859140IPR004333Transcription factor, SBP-box
PfamPF031101.6E-3061134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEWTARKPAA SPSSPPLLWD WGDHAAAGSG SSGDAPARRG GKEREAKRTK GEEGGGAEVR  60
CQVEGCGLEL GTAKDYHRKH RVCEAHTKCP RVVVAGQERR FCQQCSRFHA LSEFDQKKRS  120
CRRRLSDHNA RRRKPQPDAY AFASARLPSS LFDDRRQISF VWNKAPLSHI RPFTSPWDSS  180
SDFKLPHAKE IRELSTKVGT ITGQVHFDKS HLSNAIPTLS HGKELLPMKG PDTSITASKF  240
DGAPDLQRAL SLLSAGSCGF PDPVPQASCL IQFTGASENS SDLHLSHGGN SGPASCADEQ  300
HIAPQPQLVR FTMDASSNVY EPTFFGVNQI N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-2551134184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116133KKRSCRRRLSDHNARRRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0334150.0BT033415.1 Zea mays full-length cDNA clone ZM_BFb0223G18 mRNA, complete cds.
GenBankBT0875080.0BT087508.1 Zea mays full-length cDNA clone ZM_BFb0098L17 mRNA, complete cds.
GenBankHQ8587860.0HQ858786.1 Zea mays clone UT1800 SBP transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.10.0PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ653Z51e-101SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLK3YU030.0K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-46squamosa promoter binding protein-like 10